Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDL VVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVK VDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGG ISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTG IRIKEGGAYIAKEEIMKAMTSGYRPSMLCIEDPLLPGNDVGRSSYGAMQV KQVFDYAYIVLSHAVSPLARSYPNRDAESTLGRIIKVTQEVIDYRRWIKE KWGSKAHPSPGMDSRIKIKERIATCNGEQTQNREPESPYGQRLTLSLSSP QLLSSGSSASSVSSLSGSDVDSDTPPCTTPSVYQFSLQAPAPLMAGLPTA LPMPSGKPQPTTSRTLIMTTNNQTRFTIPPPTLGVAPVPCRQAGVEGTAS LKAVHHMSSPAIPSASPNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYS SVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSLSR
    • Amino acids
      1 to 542
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA polymerase kappa
    • DNA polymerase sigma
    • LAK 1
    • LAK-1
    • LAK1
    • OTTHUMP00000115520
    • PAP associated domain containing 7
    • PAP-associated domain-containing protein 7
    • Papd7
    • PAPD7_HUMAN
    • POLK
    • POLS
    • Polymerase (DNA directed) sigma
    • Polymerase DNA Directed Sigma
    • Terminal uridylyltransferase 5
    • Topoisomerase related function protein 4 1
    • Topoisomerase-related function protein 4-1
    • TRF4
    • TRF4 1
    • TRF4-1
    • TRF41
    • TUTase 5
    • TUTASE5
    see all
  • Function
    DNA polymerase, probably involved in DNA repair. May play a role in sister chromatid cohesion. Does not play a role in replication-dependent histone mRNA degradation.
  • Sequence similarities
    Belongs to the DNA polymerase type-B-like family.
    Contains 1 PAP-associated domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161264 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up