Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPE TPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQES LAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREE EAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAY ILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVG RYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQ EILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
    • Amino acids
      1 to 343
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C5FW
    • FLJ57420
    • GS3955
    • Hypothetical protein TRB2
    • TRB-2
    • TRB2
    • TRIB 2
    • TRIB2
    • TRIB2_HUMAN
    • Tribbles homolog 2
    see all
  • Function
    Interacts with MAPK kinases and regulates activation of MAP kinases. Does not display kinase activity.
  • Tissue specificity
    Highly expressed in peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Tribbles subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton. May associate with the cytoskeleton.
  • Information by UniProt

Images

  • ab153298 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up