Overview

  • Product name
    Recombinant Human TRIF protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AIDHSAFIILLLTSNFDCRLSLHQVNQAMMSNLTRQGSPDCVIPFLPLES SPAQLSSDTASLLSGLVRLDEHSQIFARKVANTFKPHRLQARKAMWRKEQ DTRALREQSQ
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IIAE6
    • MGC35334
    • MyD88 3
    • Proline rich vinculin and TIR domain containing protein B
    • Proline-rich
    • PRVTIRB
    • Putative NF kappa B activating protein 502H
    • Putative NF-kappa-B-activating protein 502H
    • Putative NFkB activating protein
    • TCAM1_HUMAN
    • TICAM 1
    • TICAM-1
    • Ticam1
    • TIR domain containing adapter molecule 1
    • TIR domain containing adapter protein inducing IFN beta
    • TIR domain containing adaptor inducing interferon beta
    • TIR domain-containing adapter molecule 1
    • TIR domain-containing adapter protein inducing IFN-beta
    • Toll interleukin 1 receptor domain containing adapter protein inducing interferon beta
    • Toll like receptor adaptor molecule 1
    • Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta
    • TRIF
    • TRIF protein
    • vinculin and TIR domain-containing protein B
    see all
  • Function
    Involved in innate immunity against invading pathogens. Adapter used by TLR3 and TLR4 (through TICAM2) to mediate NF-kappa-B and interferon-regulatory factor (IRF) activation, and to induce apoptosis. Ligand binding to these receptors results in TRIF recruitment through its TIR domain. Distinct protein-interaction motifs allow recruitment of the effector proteins TBK1, TRAF6 and RIPK1, which in turn, lead to the activation of transcription factors IRF3 and IRF7, NF-kappa-B and FADD respectively.
  • Tissue specificity
    Ubiquitously expressed but with higher levels in liver.
  • Sequence similarities
    Contains 1 TIR domain.
  • Domain
    The N-terminal region is essential for activation of the IFNB promoter activity.
  • Post-translational
    modifications
    Phosphorylated by TBK1.
  • Information by UniProt

Images

  • ab153605 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153605 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up