Overview

  • Product name
    Recombinant Human TRIM protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDEN CYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQ NTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGL IRAKREPIN
    • Molecular weight
      19 kDa including tags
    • Amino acids
      29 to 186
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173017 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab173017 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names
    • HSPC062
    • pp29/30
    • T cell receptor interacting molecule
    • T-cell receptor-associated transmembrane adapter 1
    • T-cell receptor-interacting molecule
    • TCRIM
    • TRAT1
    • TRAT1_HUMAN
    • TRIM
    see all
  • Function
    Stabilizes the TCR (T-cell antigen receptor)/CD3 complex at the surface of T-cells.
  • Tissue specificity
    Strongly expressed in thymus, and to a lesser extent in spleen, lymph node and peripheral blood lymphocytes. Present in T-cells and NK cells, but not B-cells (at protein level).
  • Developmental stage
    Strongly expressed in fetal thymus at weeks 17-24 of gestation. Undetectable in bone marrow and fetal liver.
  • Post-translational
    modifications
    Phosphorylated on tyrosines by LCK or FYN upon TCR activation.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab173017 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173017.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up