Recombinant Human TRIM21 protein (ab114611)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP19474
    • SpeciesHuman
    • SequenceQLANMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQS RKHRDHAMVPLEEAAQEYQEKLQVALGELRRKQELAEKLEVEIAIKRADW KKTVETQK
    • Molecular weight38 kDa including tags
    • Amino acids68 to 175

Specifications

Our Abpromise guarantee covers the use of ab114611 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114611 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 52 kDa ribonucleoprotein autoantigen Ro/SS-A
    • 52 kDa Ro protein
    • 52kD Ro/SSA autoantigen
    • Autoantigen Ro/SSA, 52-KD
    • E3 ubiquitin-protein ligase TRIM21
    • RING finger protein 81
    • RNF81
    • Ro 52
    • Ro(SS-A)
    • Ro52
    • RO52_HUMAN
    • Sicca syndrome antigen A
    • Sjoegren syndrome type A antigen
    • Sjogren syndrome antigen A1
    • Sjogren syndrome type A antigen
    • SS-A
    • SSA
    • SSA1: Sjogren syndrome antigen A1 (52kDa ribonucleoprotein autoantigen SS-A/Ro)
    • TRIM21
    • Tripartite motif protein TRIM21
    • Tripartite motif-containing 21
    • Tripartite motif-containing protein 21
    see all
  • FunctionE3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its self-ubiquitination. Component of cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes such as SCF(SKP2)-like complexes. A TRIM21-containing SCF(SKP2)-like complex is shown to mediate ubiquitination of CDKN1B ('Thr-187' phosphorylated-form), thereby promoting its degradation by the proteasome. Monoubiquitinates IKBKB that will negatively regulates Tax-induced NF-kappa-B signaling. Negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin-mediated degradation of IRF3. Mediates the ubiquitin-mediated proteasomal degradation of IgG1 heavy chain, which is linked to the VCP-mediated ER-associated degradation (ERAD) pathway. Promotes IRF8 ubiquitination, which enhanced the ability of IRF8 to stimulate cytokine genes transcription in macrophages. Plays a role in the regulation of the cell cycle progression. Enhances the decapping activity of DCP2. Exists as a ribonucleoprotein particle present in all mammalian cells studied and composed of a single polypeptide and one of four small RNA molecules. At least two isoforms are present in nucleated and red blood cells, and tissue specific differences in RO/SSA proteins have been identified. The common feature of these proteins is their ability to bind HY RNAs.2.
  • Tissue specificityIsoforms 1 and 2 are expressed in fetal and adult heart and fetal lung.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesBelongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • DomainThe coiled-coil is necessary for the cytoplasmic localization. The B30.2/SPRY domain is necessary for the cytoplasmic localization, the interaction with IRF3 and for the IRF3-driven interferon beta promoter activity. The RING-type zinc finger is necessary for ubiquitination and for the IRF3-driven interferon beta promoter activity. Interacts with SKP2 and CUL1 in a RING finger-independent manner.
  • Post-translational
    modifications
    Autoubiquitinated; does not lead to its proteasomal degradation. Deubiquitinated by USP4; leading to its stabilization.
  • Cellular localizationCytoplasm. Nucleus. Cytoplasm > P-body. Enters the nucleus upon exposure to nitric oxide. Localizes to small dot- or rod-like structures in the cytoplasm, called cytoplasmic bodies (P-body) that are located underneath the plasma membrane and also diffusely in the cytoplasm and are highly motil in cells. Cytoplasmic bodies are located along the microtubules and do not share the same cytoplasmic bodies with TRIM5. Colocalizes with DCP2 in P-body.
  • Information by UniProt

Recombinant Human TRIM21 protein images

  • ab114611 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human TRIM21 protein (ab114611)

ab114611 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114611.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"