Recombinant Human Trim22 protein (ab153072)

Overview

  • Product name
    Recombinant Human Trim22 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDFSVKVDIEKEVTCPICLELLTEPLSLDCGHSFCQACITAKIKESVIIS RGESSCPVCQTRFQPGNLRPNRHLANIVERVKEVKMSPQEGQKRDVCEHH GKKLQIFCKEDGKVICWVCELSQEHQGHQTFRINEVVKECQEKLQVALQR LIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQR ELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQ DVIDVMKRSESWTLKKPKSVSKKLKSVFRVPDLSGMLQVLKELTDVQYYW VDVMLNPGSATSNVAISVDQRQVKTVRTCTFKNSNPCDFSAFGVFGCQYF SSGKYYWEVDVSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSR YRPQYGYWVIGLQNTCEYNAFEDSSSSDPKVLTLFMAVPPCRIGVFLDYE AGIVSFFNVTNHGALIYKFSGCRFSRPAYPYFNPWNCLVPMTVCPPSS
    • Amino acids
      1 to 498
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153072 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 50 kDa stimulated trans acting factor
    • GPSTAF50
    • RING finger protein 94
    • RNF94
    • Staf 50
    • STAF50
    • Stimulated trans acting factor (50 kDa)
    • Stimulated Trans Acting Factor (homolog of Mouse Rpt 1 gene)
    • Trim22
    • Tripartite binding motif 22
    • Tripartite motif containing protein 22
    • TTRIM22RIM22
    see all
  • Relevance
    Trim22 is an interferon inducible protein that is preferentially expressed in cells of the haematopoietic system. Trim22 has been shown to be a p53 target gene. It also has an activation stage specific role connected to the paracrine crosstalk during T lymphocyte activation. It is strongly expressed in peripheral blood leukocytes, spleen, thymus, and ovary; expressed at basal levels in other tissues. There are two named isoforms.
  • Cellular localization
    Cytoplasm. Nucleus. Nucleus speckle. Nucleus; Cajal body. Note: Localizes predominanltly into the nucleus, found in cytoplasm to some extent. Forms distinct nuclear bodies that undergo dynamic changes during cell cycle progression. Nuclear bodies start to form in the early G0/G1 phase but become speckle-like in the S-phase and completely dispersed in mitosis. 35% of TRIM22 nuclear bodies overlap or are found adjacent to Cajal bodies.

Images

  • ab153072 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153072 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153072.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up