Recombinant Human TRIM23 protein (ab114830)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLL CGHTVCHDCLTRLPLHGRAIRCPFDRQVTDLGDSGVWGLKKNFALLELLE RLQNGPIGQYGAAEESIGISGESIIRCDEDEAHLASVYCTVCATHLCSEC SQVTHSTKTLAKHRRVPLADKPHEKTMCSQHQVHAIEFVCLEEGCQTSPL MCCVCKEYGKHQGHKHSVLEPEANQIRASILDMAHCIRTFTEEISDYSRK LVGIVQHIEGGEQIVEDGIGMAHTEHVPGTAENARSCIRAYFYDLHETLC RQEEMALSVVDAHVREKLIWLRQQQEDMTILLSEVSAACLHCEKTLQQDD CRVVLAKQEITRLLETLQKQQQQFTEVADHIQLDASIPVTFTKDNRVHIG PKMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKF TIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTE KELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARS GMGLYEGLDWLSRQLVAAGVLDVA
    • Molecular weight
      89 kDa including tags
    • Amino acids
      1 to 574

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP ribosylation factor domain protein 1
    • ADP-ribosylation factor domain-containing protein 1
    • ARF domain protein 1
    • ARFD1
    • E3 ubiquitin-protein ligase TRIM23
    • GTP binding protein ARD 1
    • GTP-binding protein ARD-1
    • N-acetyltransferase ARD1 human homolog of
    • N-acetyltransferase homolog of S. cerevisiae ARD1
    • RING finger protein 46
    • TRI23_HUMAN
    • TRIM23
    • Tripartite motif protein TRIM23
    • Tripartite motif-containing protein 23
    see all
  • Function
    Acts as an E3 ubiquitin-protein ligase. In the presence of the human cytomegalovirus (HCMV) protein UL144, participates in 'Lys-63'-linked auto-ubiquitination of TRAF6 resulting in the virally controlled activation of NF-kappa-B at early time of infection. The C-terminus can act as an allosteric activator of the cholera toxin catalytic subunit.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    In the C-terminal section; belongs to the small GTPase superfamily. Arf family.
    Contains 1 B box-type zinc finger.
    Contains 1 RING-type zinc finger.
  • Domain
    The RING-type zinc finger domain is responsible for E3 ubiquitin ligase activity.
  • Cellular localization
    Endomembrane system. Golgi apparatus membrane. Lysosome membrane. Membrane-associated with the Golgi complex and lysosomal structures.
  • Information by UniProt

Images

  • ab114830 analyzed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up