Recombinant Human TRIM23 protein (ab114830)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLL CGHTVCHDCLTRLPLHGRAIRCPFDRQVTDLGDSGVWGLKKNFALLELLE RLQNGPIGQYGAAEESIGISGESIIRCDEDEAHLASVYCTVCATHLCSEC SQVTHSTKTLAKHRRVPLADKPHEKTMCSQHQVHAIEFVCLEEGCQTSPL MCCVCKEYGKHQGHKHSVLEPEANQIRASILDMAHCIRTFTEEISDYSRK LVGIVQHIEGGEQIVEDGIGMAHTEHVPGTAENARSCIRAYFYDLHETLC RQEEMALSVVDAHVREKLIWLRQQQEDMTILLSEVSAACLHCEKTLQQDD CRVVLAKQEITRLLETLQKQQQQFTEVADHIQLDASIPVTFTKDNRVHIG PKMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKF TIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTE KELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARS GMGLYEGLDWLSRQLVAAGVLDVA
    • Molecular weight
      89 kDa including tags
    • Amino acids
      1 to 574

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP ribosylation factor domain protein 1
    • ADP-ribosylation factor domain-containing protein 1
    • ARF domain protein 1
    • ARFD1
    • E3 ubiquitin-protein ligase TRIM23
    • GTP binding protein ARD 1
    • GTP-binding protein ARD-1
    • N-acetyltransferase ARD1 human homolog of
    • N-acetyltransferase homolog of S. cerevisiae ARD1
    • RING finger protein 46
    • TRI23_HUMAN
    • TRIM23
    • Tripartite motif protein TRIM23
    • Tripartite motif-containing protein 23
    see all
  • Function
    Acts as an E3 ubiquitin-protein ligase. In the presence of the human cytomegalovirus (HCMV) protein UL144, participates in 'Lys-63'-linked auto-ubiquitination of TRAF6 resulting in the virally controlled activation of NF-kappa-B at early time of infection. The C-terminus can act as an allosteric activator of the cholera toxin catalytic subunit.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    In the C-terminal section; belongs to the small GTPase superfamily. Arf family.
    Contains 1 B box-type zinc finger.
    Contains 1 RING-type zinc finger.
  • Domain
    The RING-type zinc finger domain is responsible for E3 ubiquitin ligase activity.
  • Cellular localization
    Endomembrane system. Golgi apparatus membrane. Lysosome membrane. Membrane-associated with the Golgi complex and lysosomal structures.
  • Information by UniProt

Recombinant Human TRIM23 protein images

  • ab114830 analyzed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human TRIM23 protein (ab114830)

ab114830 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up