Recombinant Human TRIM25 protein (ab152814)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLC PQCRAVYQARPQLHKNTVLCNVVEQFLQADLAREPPADVWTPPARASAPS PNAQVACDHCLKEAAVKTCLVCMASFCQEHLQPHFDSPAFQDHPLQPPVR DLLRRKCSQHNRLREFFCPEHSECICHICLVEHKTCSPASLSQASADLEA TLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVEQLQQEYTEMKA LLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT KRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQ CIGRLQELTPSSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALP SKLPTFGAPEQLVDLKQAGLEAAAKATSSHPNSTSLKAKVLETFLAKSRP ELLEYYIKVILDYNTAHNKVALSECYTVASVAEMPQNYRPHPQRFTYCSQ VLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPESRLGRNSASWC VEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLM YKFRVDFTEALYPAFWVFSAGATLSICSPK
    • Molecular weight
      97 kDa including tags
    • Amino acids
      1 to 630

Specifications

Our Abpromise guarantee covers the use of ab152814 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin/ISG15 ligase TRIM25
    • EFP
    • Estrogen responsive finger protein
    • Estrogen-responsive finger protein
    • RING finger protein 147
    • RNF 147
    • RNF147
    • TRI25
    • TRI25_HUMAN
    • TRIM 25
    • Trim25
    • Tripartite motif containing 25
    • Tripartite motif containing protein 25
    • Tripartite motif protein TRIM25
    • Tripartite motif-containing protein 25
    • Tripartite motifcontaining25
    • Ubiquitin/ISG15-conjugating enzyme TRIM25
    • Z147
    • Zinc finger protein 147
    • Zinc finger protein 147 (estrogen responsive finger protein)
    • Zinc finger protein-147
    • ZNF 147
    • ZNF147
    see all
  • Function
    Functions as an ubiquitin E3 ligase and as an ISG15 E3 ligase. Involved in innate immune defense against viruses by mediating ubiquitination of DDX58. Mediates 'Lys-63'-linked polyubiquitination of the DDX58 N-terminal CARD-like region which is crucial for triggering the cytosolic signal transduction that leads to the production of interferons in response to viral infection. Promotes ISGylation of 14-3-3 sigma (SFN), an adapter protein implicated in the regulation of a large spectrum signaling pathway. Mediates estrogen action in various target organs.
  • Tissue specificity
    Ubiquitous.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Domain
    The RING-type zinc finger is important for ISG15 E3 ligase activity and autoISGylation. AutoISGylation negatively regulates ISG15 E3 ligase activity.
    The C-terminal B30.2/SPRY domain interacts with the first N-terminal CARD domain of DDX58.
  • Post-translational
    modifications
    Auto-ISGylated.
  • Cellular localization
    Cytoplasm. Colocalized with DDX58 at cytoplasmic perinuclear bodies.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152814 stained with Coomassie Blue.

References

ab152814 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152814.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up