Recombinant Human TRIM29 protein (ab153244)

Overview

  • Product name
    Recombinant Human TRIM29 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEA AEGKSLGSALKPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSME GKRSPYAGLQLGAAKKPPVTFAEKGELRKSIFSESRKPTVSIMEPGETRR NSYPRADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVCQASFCELHLK PHLEGAAFRDHQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQ EHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIK SFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDAL DERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLL EGEGLGQSLGNFKDDLLNVCMRHVEKMCKADLSRNFIERNHMENGGDHRY VNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQK NFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRS QSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP
    • Amino acids
      1 to 588
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ataxia telangiectasia group D associated protein
    • Ataxia telangiectasia group D-associated protein
    • ATDC
    • FLJ36085
    • TRI29_HUMAN
    • TRIM 29
    • TRIM29
    • Tripartite motif containing 29
    • Tripartite motif containing protein 29
    • Tripartite motif protein 29
    • Tripartite motif protein TRIM29
    • Tripartite motif-containing protein 29
    see all
  • Function
    It is able to complement the radiosensitivity defect of an ataxia telangiectasia (AT) fibroblast cell line.
  • Tissue specificity
    Expressed in placenta, prostate and thymus.
  • Sequence similarities
    Contains 1 B box-type zinc finger.
  • Post-translational
    modifications
    Constitutively phosphorylated by PKC on serine/threonine in A431 cells.
  • Cellular localization
    Cytoplasm. Colocalizes with intermediate filaments.
  • Information by UniProt

Images

  • ab153244 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153244 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up