Recombinant Human TRIM32 protein (ab161487)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAEERRRDFGEKLT RLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRK
    • Amino acids
      105 to 204
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161487 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 72 kda Tat interacting Protein
    • 72 kDa Tat-interacting protein
    • BBS11
    • E3 ubiquitin-protein ligase TRIM32
    • HT2A
    • LGMD2H
    • Limb girdle muscular dystrophy 2H
    • Limb girdle muscular dystrophy 2H (autosomal recessive)
    • Muscular dystrophy Hutterite type
    • TAT interactive protein 72KD
    • TATIP
    • TRI32_HUMAN
    • Trim32
    • Tripartite Motif Containing Protein 32
    • Tripartite motif-containing protein 32
    • Zinc finger protein HT2A
    see all
  • Function
    Has an E3 ubiquitin ligase activity. Ubiquitinates DTNBP1 (dysbindin) and promotes its degradation. May play a significant role in mediating the biological activity of the HIV-1 Tat protein in vivo. Binds specifically to the activation domain of HIV-1 Tat and can also interact with the HIV-2 and EIAV Tat proteins in vivo.
  • Tissue specificity
    Spleen, thymus, prostate, testis, ovary, intestine, colon and skeletal muscle.
  • Pathway
    Protein modification; protein ubiquitination.
  • Involvement in disease
    Limb-girdle muscular dystrophy 2H (LGMD2H) [MIM:254110]: An autosomal recessive degenerative myopathy characterized by pelvic girdle, shoulder girdle and quadriceps muscle weakness. Clinical phenotype and severity are highly variable. Disease progression is slow and most patients remain ambulatory into the sixth decade of life. Note=The disease is caused by mutations affecting the gene represented in this entry.
    Bardet-Biedl syndrome 11 (BBS11) [MIM:209900]: A syndrome characterized by usually severe pigmentary retinopathy, early-onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation. Secondary features include diabetes mellitus, hypertension and congenital heart disease. Bardet-Biedl syndrome inheritance is autosomal recessive, but three mutated alleles (two at one locus, and a third at a second locus) may be required for clinical manifestation of some forms of the disease. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 5 NHL repeats.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Ubiquitinated.
  • Cellular localization
    Cytoplasm. Localized in cytoplasmic bodies, often located around the nucleus.
  • Information by UniProt

Images

  • ab161487 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161487 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161487.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up