Recombinant Human TRIM35 protein (ab161529)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SGFWYVCRTQGVEGDHCVTSDPATSPLVLAIPRRLRVELECEEGELSFYD AERHCHLYTFHARFGEVRPYFYLGGARGAGPPEPLRICPLHISVKEELDG
    • Amino acids
      394 to 493
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161529 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 0710005M05Rik
    • A430106H13Rik
    • AW046487
    • Hemopoietic lineage switch protein 5
    • HLS5
    • KIAA1098
    • Macrophage derived apoptosis inducing RBCC protein
    • MAIR
    • MGC17233
    • mKIAA1098
    • NC8
    • Protein MAIR
    • Protein Nc8
    • TRI35_HUMAN
    • TRIM35
    • Tripartite motif containing 35
    • Tripartite motif containing protein 35
    • Tripartite motif-containing protein 35
    see all
  • Function
    May play a role as a tumor suppressor. Implicated in the cell death mechanism.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Domain
    The RING finger domain and the coiled-coil region are required for the apoptosis-inducing activity.
  • Cellular localization
    Cytoplasm. Nucleus. Found predominantly in cytoplasm with a granular distribution. Found in punctuate nuclear bodies.
  • Information by UniProt

Images

  • ab161529 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161529 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161529.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up