Recombinant Human TRIM37 protein (ab116888)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO94972
    • SpeciesHuman
    • SequenceGHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDTENEE QEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR
    • Molecular weight37 kDa including tags
    • Amino acids865 to 964

Specifications

Our Abpromise guarantee covers the use of ab116888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin protein ligase TRIM37
    • E3 ubiquitin-protein ligase TRIM37
    • KIAA0898
    • MUL
    • MUL protein
    • Mulibrey nanism gene
    • Mulibrey nanism protein
    • POB 1
    • POB1
    • RING B box coiled coil protein
    • TEF 3
    • TEF3
    • TRI37_HUMAN
    • TRIM 37
    • Trim37
    • Tripartite motif containing 37
    • Tripartite motif containing 37 protein
    • Tripartite motif containing protein 37
    • Tripartite motif-containing protein 37
    see all
  • FunctionE3 ubiquitin-protein ligase.
  • Tissue specificityUbiquitous.
  • PathwayProtein modification; protein ubiquitination.
  • Involvement in diseaseDefects in TRIM37 are the cause of mulibrey nanism (MUL) [MIM:253250]; also known as muscle-liver-brain-eye nanism. MUL is an autosomal recessive disorder that involves several tissues of mesodermal origin, implying a defect in a highly pleiotropic gene. Characteristic features include severe growth failure of prenatal onset and constrictive pericardium with consequent hepatomegaly. In addition, muscle hypotonia, J-shaped sella turcica, yellowish dots in the ocular fundi, typical dysmorphic features and hypoplasia of various endocrine glands causing hormonal deficiency are common.
  • Sequence similaritiesBelongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 MATH domain.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Auto-ubiquitinated.
  • Cellular localizationCytoplasm > perinuclear region. Peroxisome. Found in vesicles of the peroxisome. Aggregates as aggresomes, a perinuclear region where certain misfolded or aggregated proteins are sequestered for proteasomal degradation.
  • Information by UniProt

Recombinant Human TRIM37 protein images

  • 12.5% SDS-PAGE showing ab116888 at approximately 36.63kDa stained with Coomassie Blue

References for Recombinant Human TRIM37 protein (ab116888)

ab116888 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"