Recombinant Human TRIM37 protein (ab167952)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQ CPHCRAPLQL RELVNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENH HEKLSVFCWTCKKCICHQCALW GGMHGGHTFKPLAEIYEQHVTKVNEE VAKLRRRLMELISLVQEVERNVEAVRNAKDERVR EIRNAVEMMIARLD TQLKNKLITLMGQKTSLTQETELLESLLQEVEHQLRSCSKSELISK SS EILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSATFVLENFSTLRQR ADPVYSPP LQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSK YEYRVEMVHQSCNDPTKNII REFASDFEVGECWGYNRFFRLDLLANEG YLNPQNDTVILRFQVRSPTFFQKSRDQHWYIT QLEAAQTSYIQQINNL KERLTIELSRTQKSRDLSPPDNHLSPQNDDALETRAKKSACSDM LLEG GPTTASVREAKEDEEDEEKIQNEDYHHELSDGDLDLDLVYEDEVNQLDGS SSSASS TATSNTEENDIDEETMSGENDVEYNNMELEEGELMEDAAAAG PAGSSHGYVGSSSRISRR THLCSAATSSLLDIDPLILIHLLDLKDRSS IENLWGLQPRPPASLLQPTASYSRKDKDQR KQQAMWRVPSDLKMLKRL KTQMAEVRCMKTDVKNTLSEIKSSSAASGDMQTSLFSADQAA LAACGT ENSGRLQDLGMELLAKSSVANCYIRNSTNKKSNSPKPARSSVAGSLSLRR AVDP GENSRSKGDCQTLSEGSPGSSQSGSRHSSPRALIHGSIGDILPK TEDRQCKALDSDAVVV AVFSGLPAVEKRRKMVTLGANAKGGHLEGLQM TDLENNSETGELQPVLPEGASAAPEEGM SSDSDIECDTENEEQEEHTS VGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDE NSGR
    • Molecular weight
      140 kDa including tags
    • Amino acids
      1 to 964
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab167952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity
    > 80 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names
    • E3 ubiquitin protein ligase TRIM37
    • E3 ubiquitin-protein ligase TRIM37
    • KIAA0898
    • MUL
    • MUL protein
    • Mulibrey nanism gene
    • Mulibrey nanism protein
    • POB 1
    • POB1
    • RING B box coiled coil protein
    • TEF 3
    • TEF3
    • TRI37_HUMAN
    • TRIM 37
    • Trim37
    • Tripartite motif containing 37
    • Tripartite motif containing 37 protein
    • Tripartite motif containing protein 37
    • Tripartite motif-containing protein 37
    see all
  • Function
    E3 ubiquitin-protein ligase.
  • Tissue specificity
    Ubiquitous.
  • Pathway
    Protein modification; protein ubiquitination.
  • Involvement in disease
    Defects in TRIM37 are the cause of mulibrey nanism (MUL) [MIM:253250]; also known as muscle-liver-brain-eye nanism. MUL is an autosomal recessive disorder that involves several tissues of mesodermal origin, implying a defect in a highly pleiotropic gene. Characteristic features include severe growth failure of prenatal onset and constrictive pericardium with consequent hepatomegaly. In addition, muscle hypotonia, J-shaped sella turcica, yellowish dots in the ocular fundi, typical dysmorphic features and hypoplasia of various endocrine glands causing hormonal deficiency are common.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 MATH domain.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Auto-ubiquitinated.
  • Cellular localization
    Cytoplasm > perinuclear region. Peroxisome. Found in vesicles of the peroxisome. Aggregates as aggresomes, a perinuclear region where certain misfolded or aggregated proteins are sequestered for proteasomal degradation.
  • Information by UniProt

Images

  • SDS Page analysis of ab167952

References

ab167952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up