Recombinant Human TRIM68 protein (ab162969)

Overview

  • Product name
    Recombinant Human TRIM68 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KQSIVWEFEKYQRLLEKKQPPHRQLGAEVAAALASLQREAAETMQKLELN HSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEP
    • Amino acids
      181 to 280
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase TRIM68
    • FLJ10369
    • GC109
    • MGC126176
    • RING finger protein 137
    • RNF 137
    • RNF137
    • Ro/SSA1 related protein
    • SS 56
    • SS-56
    • SS56
    • SSA protein SS 56
    • SSA protein SS-56
    • TRI68_HUMAN
    • TRIM 68
    • Trim68
    • Tripartite motif containing 68
    • Tripartite motif containing protein 68
    • Tripartite motif-containing protein 68
    see all
  • Function
    Functions as an ubiquitin E3 ligase. Acts as a coactivator of androgen receptor (AR) depending on its ubiquitin ligase activity.
  • Tissue specificity
    Widely expressed. Expressed at high levels in prostate cancer cell lines. Up-regulation could be restricted to androgen-dependent cells.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Domain
    The RING domain is essential for ubiquitin E3 ligase activity.
  • Post-translational
    modifications
    Auto-ubiquitinated.
  • Cellular localization
    Cytoplasm > perinuclear region. Nucleus. Colocalized with AR in nucleus.
  • Information by UniProt

Images

  • ab162969 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162969 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162969.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up