Recombinant Human TRIM71 protein (ab153596)

Overview

  • Product name
    Recombinant Human TRIM71 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSGGGGGGPG AAARRLHVLPCLHAFCRPCLEAHRLPAAGGGAAGEPLKLRCPVCDQKVVL AEAAGMDALPSSAFLLSNLLDAVVATADEPPPKNGRAGAPAGAGGHSNHR HHAHHAHPRASASAPPLPQAPQPPAPSRSAPGGPAASPSALLLRRPHGCS SCDEGNAASSRCLDCQEHLCDNCVRAHQRVRLTKDHYIERGPPGPGAAAA AQQLGLGPPFPGPPFSILSVFPERLGFCQHHDDEVLHLYCDTCSVPICRE CTMGRHGGHSFIYLQEALQDSRALTIQLLADAQQGRQAIQLSIEQAQTVA EQVEMKAKVVQSEVKAVTARHKKALEERECELLWKVEKIRQVKAKSLYLQ VEKLRQNLNKLESTISAVQQVLEEGRALDILLARDRMLAQVQELKTVRSL LQPQEDDRVMFTPPDQALYLAIKSFGFVSSGAFAPLTKATGDGLKRALQG KVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEVSDQQNGTYVV SYRPQLEGEHLVSVTLCNQHIENSPFKVVVKSGRSYVGIGLPGLSFGSEG DSDGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGAFHHKFGTLGSRP GQFDRPAGVACDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQF NYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNKYGFEGALWKHFDSP RGVAFNHEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGTGNGQFLRPQGV AVDQEGRIIVADSRNHRVQMFESNGSFLCKFGAQGSGFGQMDRPSGIAIT PDGMIVVVDFGNNRILVF
    • Amino acids
      1 to 868
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2610206G21Rik
    • Abnormal cell LINeage LIN 41
    • AL022943
    • E3 ubiquitin-protein ligase TRIM71
    • Gm1127
    • Homolog of C. elegans Lin 41
    • LIN 41
    • LIN41
    • LIN41_HUMAN
    • mlin 41
    • Protein lin 41 homolog
    • Protein lin-41 homolog
    • RGD1566388
    • Ripply2
    • TRIM 71
    • TRIM71
    • Tripartite motif containing 71
    • Tripartite motif-containing protein 71
    see all
  • Function
    E3 ubiquitin-protein ligase that cooperates with the microRNAs (miRNAs) machinery and promotes embryonic stem cells proliferation and maintenance. Binds to miRNAs and associates with AGO2, participating in post-transcriptional repression of transcripts such as CDKN1A. Facilitates the G1-S transition to promote rapid embryonic stem cell self-renewal by repressing CDKN1A expression. Required to maintain proliferation and prevent premature differentiation of neural progenitor cells during early neural development: positively regulates FGF signaling by controlling the stability of SHCBP1.
  • Tissue specificity
    Specifically expressed in testis.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 2 B box-type zinc fingers.
    Contains 1 filamin repeat.
    Contains 6 NHL repeats.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Autoubiquitinated.
  • Cellular localization
    Cytoplasm, P-body.
  • Information by UniProt

Images

  • ab153596 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153596 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up