Recombinant Human Triosephosphate isomerase protein (ab100826)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP60174
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAPSRKFFVGGNWKMNGRKQSLGELIGTLN AAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEIS PGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGE KLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGF LVGGASLKPEFVDIINAKQ
    • Molecular weight29 kDa including tags
    • Amino acids1 to 249
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab100826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab100826 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • epididymis secretory protein Li 49
    • HEL-S-49
    • MGC88108
    • TIM
    • TPI
    • TPI 1
    • TPI1
    • TPID
    • Triose phosphate isomerase
    • Triose phosphate isomerase 1
    • Triosephosphate isomerase
    • Triosephosphate isomerase 1
    see all
  • RelevanceTriosephosphate isomerase (TIM) catalyses the reversible interconversion of G3P and DHAP. Only G3P can be used in glycolysis, therefore TIM is essential for energy production, allowing two molecules of G3P to be produced for every glucose molecule, thereby doubling the energy yield. Defects in TPI1 are the cause of triosephosphate isomerase deficiency (TPI deficiency) [MIM:190450]. TPI deficiency is an autosomal recessive disorder. It is the most severe clinical disorder of glycolysis. It is associated with neonatal jaundice, chronic hemolytic anemia, progressive neuromuscular dysfunction, cardiomyopathy and increased susceptibility to infection.
  • Cellular localizationCytoplasmic and Nuclear; extracellular vesicle exosome; extracellular space.

Recombinant Human Triosephosphate isomerase protein images

  • 15% SDS-PAGE analysis of 3µg ab100826.

References for Recombinant Human Triosephosphate isomerase protein (ab100826)

ab100826 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab100826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"