Recombinant Human Triosephosphate isomerase protein (ab88134)

Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPP TAY IDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGAT WVVLGH SERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDER EAGITEKVV FEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ QAQEVHEKLRGW LKSNVSDAVAQSTRIIYGGSVTGATCKELASQP DVDGFLVGGASLKPE FVDIINAKQ

Specifications

Our Abpromise guarantee covers the use of ab88134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    purified by affinity chromatography
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • epididymis secretory protein Li 49
    • HEL-S-49
    • MGC88108
    • TIM
    • TPI
    • TPI 1
    • TPI1
    • TPID
    • Triose phosphate isomerase
    • Triose phosphate isomerase 1
    • Triosephosphate isomerase
    • Triosephosphate isomerase 1
    see all
  • RelevanceTriosephosphate isomerase (TIM) catalyses the reversible interconversion of G3P and DHAP. Only G3P can be used in glycolysis, therefore TIM is essential for energy production, allowing two molecules of G3P to be produced for every glucose molecule, thereby doubling the energy yield. Defects in TPI1 are the cause of triosephosphate isomerase deficiency (TPI deficiency) [MIM:190450]. TPI deficiency is an autosomal recessive disorder. It is the most severe clinical disorder of glycolysis. It is associated with neonatal jaundice, chronic hemolytic anemia, progressive neuromuscular dysfunction, cardiomyopathy and increased susceptibility to infection.
  • Cellular localizationCytoplasmic and Nuclear; extracellular vesicle exosome; extracellular space.

References for Recombinant Human Triosephosphate isomerase protein (ab88134)

ab88134 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"