Recombinant Human TRIP230 protein (ab160427)

Overview

  • Product name
    Recombinant Human TRIP230 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LRQEMLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRL MGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV
    • Amino acids
      1756 to 1855
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CEV 14
    • CEV14
    • Clonal evolution related gene on chromosome 14
    • GMAP 210
    • GMAP210
    • Golgi associated microtubule binding protein 210
    • Thyroid hormone receptor interactor 11
    • Thyroid receptor interacting protein 11
    • TRIP 11
    • TRIP 230
    • TRIP11
    see all
  • Relevance
    TRIP230 was identified through its ability to interact functionally with thyroid hormone receptor-beta. It has also been found in association with the Golgi apparatus and microtubules. TRIP230 binds the ligand binding domain of the thyroid receptor (THRB) in the presence of triiodothyronine and enhances THRB-modulated transcription. This protein is probably involved in maintaining cis-Golgi structure.
  • Cellular localization
    Cell Membrane and Golgi Apparatus

Images

  • ab160427 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up