Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLL SSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASP
    • Amino acids
      51 to 148
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC10556
    • MGC10558
    • MGC29959
    • MGC3837
    • MGC4423
    • OIP-1
    • OIP1
    • OPA interacting protein 1
    • OPA-interacting protein 1
    • Thyroid hormone receptor interactor 6
    • Thyroid receptor interacting protein 6
    • Thyroid receptor-interacting protein 6
    • TR-interacting protein 6
    • TRIP-6
    • Trip6
    • TRIP6_HUMAN
    • TRIP6i2
    • ZRP 1
    • ZRP-1
    • Zyxin-related protein 1
    see all
  • Function
    Relays signals from the cell surface to the nucleus to weaken adherens junction and promote actin cytoskeleton reorganization and cell invasiveness. Involved in lysophosphatidic acid-induced cell adhesion and migration. Acts as a transcriptional coactivator for NF-kappa-B and JUN, and mediates the transrepression of these transcription factors induced by glucocorticoid receptor.
  • Tissue specificity
    Abundantly expressed in kidney, liver and lung. Lower levels in heart, placenta and pancreas. Expressed in colonic epithelial cells. Up-regulated in colonic tumors.
  • Sequence similarities
    Belongs to the zyxin/ajuba family.
    Contains 3 LIM zinc-binding domains.
  • Domain
    The LIM zinc-binding domains mediate interaction with LPAR2 and with S.typhimurium protein sseI.
  • Post-translational
    modifications
    Phosphorylation at Tyr-55 by SRC is required for enhancement of lysophosphatidic acid-induced cell migration. Tyr-55 is dephosphorylated by PTPN13.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell junction > focal adhesion. Nucleus. Cytoplasm. Shuttles between nucleus and cytoplasm.
  • Information by UniProt

Images

  • ab159750 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159750 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up