Recombinant Human Tristetraprolin protein (ab112374)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP26651
    • SpeciesHuman
    • SequenceMDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGV TSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTT PSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKF YLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPP PGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCC PSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE AGVFAPPQPVAAPRRLPIFNRISVSE
    • Molecular weight62 kDa including tags
    • Amino acids1 to 326

Specifications

Our Abpromise guarantee covers the use of ab112374 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesab112374 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • G0/G1 switch regulatory protein 24
    • G0S24
    • GOS24
    • Growth factor-inducible nuclear protein NUP475
    • NUP475
    • Protein TIS11A
    • RNF162A
    • TIS 11
    • TIS11
    • TIS11A
    • Tristetraprolin
    • Tristetraproline
    • TTP
    • TTP_HUMAN
    • Zfp-36
    • ZFP36
    • Zinc finger protein 36
    • Zinc finger protein 36 homolog
    • Zinc finger protein 36, C3H type, homolog (mouse)
    • Zinc finger protein, C3H type, 36 homolog
    see all
  • FunctionmRNA-binding protein involved in post-transcriptional regulation of AU-rich element (ARE)-containing mRNAs. Acts by specifically binding ARE-containing mRNAs and promoting their degradation. Recruits deadenylase CNOT7 (and probably the CCR4-NOT complex) via association with CNOT1. Plays a key role in the post-transcriptional regulation of tumor necrosis factor (TNF). Plays a key role in the post-transcriptional regulation of tumor necrosis factor (TNF).
  • Sequence similaritiesContains 2 C3H1-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylation by MAPKAPK2 increases its stability and binding to 14-3-3 proteins, leading to reduce its ARE affinity leading to inhibition of degradation of ARE-containing transcripts. Phosphorylated upon mitogen stimulation.
  • Cellular localizationNucleus. Cytoplasm. Localizes to stress granules upon energy starvation. phosphorylation by MAPKAPK2 promotes exclusion from stress granules.
  • Information by UniProt

Recombinant Human Tristetraprolin protein images

  • ab112374 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Tristetraprolin protein (ab112374)

ab112374 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112374.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"