Recombinant Human TrkA protein (Fc Chimera) (ab83562)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • AccessionP04629
    • SpeciesHuman
    • SequenceTheoretical sequence: AAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTEL YIENQQH LQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSR LNLSF NALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGL GGV PEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRC Q VEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKN VTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQ P APSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHV NNG NYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDT NSTSE IPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVV SVLTVLHQDWLNGKEYKCRVSNKALPAPIEKTISKAK GQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK
    • Amino acids33 to 405
    • Additional sequence informationFusion of aa 1-405 of human TrkA and aa 93-330 of Fc region of human IgG1 (P01857). The chimeric protein was expressed in modified human 293 cells.

Specifications

Our Abpromise guarantee covers the use of ab83562 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.

General Info

  • Alternative names
    • gp140trk
    • High affinity nerve growth factor receptor
    • High affinity nerve growth factor receptor precursor
    • MTC
    • Neurotrophic tyrosine kinase receptor type 1
    • NTRK1
    • NTRK1_HUMAN
    • Oncogene TRK
    • p14-TrkA
    • p140 TrkA
    • p140-TrkA
    • Slow nerve growth
    • TRK
    • Trk A
    • Trk-A
    • TRK1
    • TRK1-transforming tyrosine kinase protein
    • Tropomyosin-related kinase A
    • Tyrosine kinase receptor
    • Tyrosine kinase receptor A
    see all
  • FunctionReceptor tyrosine kinase involved in the development and the maturation of the central and peripheral nervous systems through regulation of proliferation, differentiation and survival of sympathetic and nervous neurons. High affinity receptor for NGF which is its primary ligand, it can also bind and be activated by NTF3/neurotrophin-3. However, NTF3 only supports axonal extension through NTRK1 but has no effect on neuron survival. Upon dimeric NGF ligand-binding, undergoes homodimerization, autophosphorylation and activation. Recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that regulate distinct overlapping signaling cascades driving cell survival and differentiation. Through SHC1 and FRS2 activates a GRB2-Ras-MAPK cascade that regulates cell differentiation and survival. Through PLCG1 controls NF-Kappa-B activation and the transcription of genes involved in cell survival. Through SHC1 and SH2B1 controls a Ras-PI3 kinase-AKT1 signaling cascade that is also regulating survival. In absence of ligand and activation, may promote cell death, making the survival of neurons dependent on trophic factors.
    Isoform TrkA-III is resistant to NGF, constitutively activates AKT1 and NF-kappa-B and is unable to activate the Ras-MAPK signaling cascade. Antagonizes the anti-proliferative NGF-NTRK1 signaling that promotes neuronal precursors differentiation. Isoform TrkA-III promotes angiogenesis and has oncogenic activity when overexpressed.
  • Tissue specificityIsoform TrkA-I is found in most non-neuronal tissues. Isoform TrkA-II is primarily expressed in neuronal cells. TrkA-III is specifically expressed by pluripotent neural stem and neural crest progenitors.
  • Involvement in diseaseCongenital insensitivity to pain with anhidrosis
    Chromosomal aberrations involving NTRK1 are found in papillary thyroid carcinomas (PTCs) (PubMed:2869410, PubMed:7565764, PubMed:1532241). Translocation t(1;3)(q21;q11) with TFG generates the TRKT3 (TRK-T3) transcript by fusing TFG to the 3'-end of NTRK1 (PubMed:7565764). A rearrangement with TPM3 generates the TRK transcript by fusing TPM3 to the 3'-end of NTRK1 (PubMed:2869410). An intrachromosomal rearrangement that links the protein kinase domain of NTRK1 to the 5'-end of the TPR gene forms the fusion protein TRK-T1. TRK-T1 is a 55 kDa protein reacting with antibodies against the C-terminus of the NTRK1 protein (PubMed:1532241).
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 protein kinase domain.
  • DomainThe transmembrane domain mediates interaction with KIDINS220.
    The extracellular domain mediates interaction with NGFR.
  • Post-translational
    modifications
    Ligand-mediated autophosphorylation. Interaction with SQSTM1 is phosphotyrosine-dependent. Autophosphorylation at Tyr-496 mediates interaction and phosphorylation of SHC1.
    N-glycosylated (Probable). Isoform TrkA-I is N-glycosylated.
    Ubiquitinated. Undergoes polyubiquitination upon activation; regulated by NGFR. Ubiquitination regulates the internalization of the receptor.
  • Cellular localizationCell membrane. Early endosome membrane. Late endosome membrane. Internalized to endosomes upon binding of NGF or NTF3 and further transported to the cell body via a retrograde axonal transport. Localized at cell membrane and early endosomes before nerve growth factor (NGF) stimulation. Recruited to late endosomes after NGF stimulation. Colocalized with RAPGEF2 at late endosomes (By similarity).
  • Information by UniProt

Recombinant Human TrkA protein (Fc Chimera) images

  • Lane 1 – MW markers; Lane 2 – ab83562; Lane 3 – ab83562 treated with PNGase F to remove potential N-linked glycans; 10 µg protein loaded per lane; Deep Purple™ stained.
    The drop in MW after treatment with PNGase F indicates presence of N-linked glycans.
  • Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates that ab83562 exists in multiple isoforms, which differ according to their level of post-translational modification. Expression of these isoforms is highly significant for cell biology, as they more closely resemble the native human proteins.
    The triangle indicates theoretical pI and MW of the protein.

References for Recombinant Human TrkA protein (Fc Chimera) (ab83562)

ab83562 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83562.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"