Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAY VGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDL SELILVGNPFTCSCDIMWIK
    • Amino acids
      41 to 160
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159016 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI848316
    • BDNF tropomyosine receptor kinase B
    • BDNF/NT 3 growth factors receptor
    • BDNF/NT-3 growth factors receptor
    • Brain derived neurotrophic factor receptor
    • C030027L06Rik
    • EC 2.7.10.1
    • GP145 TrkB
    • GP145-TrkB
    • GP145-TrkB/GP95-TrkB
    • GP95 TrkB
    • Neurotrophic receptor tyrosine kinase 2
    • Neurotrophic tyrosine kinase receptor type 2
    • Neurotrophin receptor tyrosine kinase type 2
    • NTRK 2
    • Ntrk2
    • NTRK2_HUMAN
    • Obesity, hyperphagia, and developmental delay, included
    • RATTRKB1
    • Tkrb
    • Trk B
    • Trk-B
    • TRKB
    • TrkB tyrosine kinase
    • TRKB1
    • Tropomyosin related kinase B
    • tyrosine kinase receptor B
    • Tyrosine receptor kinase B
    see all
  • Function
    Receptor for brain-derived neurotrophic factor (BDNF), neurotrophin-3 and neurotrophin-4/5 but not nerve growth factor (NGF). Involved in the development and/or maintenance of the nervous system. This is a tyrosine-protein kinase receptor. Known substrates for the TRK receptors are SHC1, PI-3 kinase, and PLC-gamma-1.
  • Tissue specificity
    Isoform TrkB is widely expressed, mainly in the nervous tissue. In the CNS, expression is observed in the cerebral cortex, hippocampus, thalamus, choroid plexus, granular layer of the cerebellum, brain stem, and spinal cord. In the peripheral nervous system, it is expressed in many cranial ganglia, the ophtalmic nerve, the vestibular system, multiple facial structures, the submaxillary glands, and dorsal root ganglia. Isoform TrkB-T1 is expressed in multiple tissues, mainly in brain, pancreas, kidney and heart. Isoform TrkB-T-Shc is predominantly expressed in brain.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Ligand-mediated auto-phosphorylation.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159016 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159016 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159016.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up