Recombinant human TrkB protein (Fc Chimera) (ab83565)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • AccessionQ16620
    • SpeciesHuman
    • SequenceTheoretical Sequence: CPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITE IFIANQK RLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQ HINFT RNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAK SSP DTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSI T LSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSG KQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTV K GNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTH MNN GDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYED YGTAA NDIGDTTNRSNEIPSTDVTDKTGRIPKVDKKVEPKSCDKTH TCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVF SCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids32 to 428
    • Additional sequence informationFusion of aa 1-428 of human TrkB and aa 93-330 of Fc region of human IgG1 (P01857). The chimeric protein was expressed in modified human 293 cells.

Specifications

Our Abpromise guarantee covers the use of ab83565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityab83565 chimera bound to protein A sepharose beads is able to pull down its ligand, BDNF.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Additional notesab83565 chimera bound to protein A sepharose beads is able to pull down its ligand, BDNF.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • AI848316
    • BDNF tropomyosine receptor kinase B
    • BDNF/NT 3 growth factors receptor
    • BDNF/NT-3 growth factors receptor
    • Brain derived neurotrophic factor receptor
    • C030027L06Rik
    • EC 2.7.10.1
    • GP145 TrkB
    • GP145-TrkB
    • GP145-TrkB/GP95-TrkB
    • GP95 TrkB
    • Neurotrophic tyrosine kinase receptor type 2
    • Neurotrophin receptor tyrosine kinase type 2
    • NTRK 2
    • Ntrk2
    • NTRK2_HUMAN
    • Obesity, hyperphagia, and developmental delay, included
    • RATTRKB1
    • Tkrb
    • Trk B
    • Trk-B
    • TRKB
    • TrkB tyrosine kinase
    • TRKB1
    • Tropomyosin related kinase B
    • tyrosine kinase receptor B
    • Tyrosine receptor kinase B
    see all
  • FunctionReceptor for brain-derived neurotrophic factor (BDNF), neurotrophin-3 and neurotrophin-4/5 but not nerve growth factor (NGF). Involved in the development and/or maintenance of the nervous system. This is a tyrosine-protein kinase receptor. Known substrates for the TRK receptors are SHC1, PI-3 kinase, and PLC-gamma-1.
  • Tissue specificityIsoform TrkB is widely expressed, mainly in the nervous tissue. In the CNS, expression is observed in the cerebral cortex, hippocampus, thalamus, choroid plexus, granular layer of the cerebellum, brain stem, and spinal cord. In the peripheral nervous system, it is expressed in many cranial ganglia, the ophtalmic nerve, the vestibular system, multiple facial structures, the submaxillary glands, and dorsal root ganglia. Isoform TrkB-T1 is expressed in multiple tissues, mainly in brain, pancreas, kidney and heart. Isoform TrkB-T-Shc is predominantly expressed in brain.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Ligand-mediated auto-phosphorylation.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant human TrkB protein (Fc Chimera) images

  • Lane 1 – MW markers; Lane 2 – ab83565; Lane 3 – ab83565 treated with PNGase F to remove potential N-linked glycans. 10 µg protein loaded per lane. Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Band in lane 3 at 35 kDa is PNGase F.
  • A sample of ab83565 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. 40 µg protein loaded per lane; Deep Purple™ stained. Spot train indicates presence of multiple isoforms of TrkB FcB Chimera. Spots within the spot train were cut from the gel and identified as TrkB FcB Chimera by protein mass fingerprinting.
  • Densitometry scan, derived from the 2D gel image, demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification. The triangle indicates theoretical pI and MW of the protein.

References for Recombinant human TrkB protein (Fc Chimera) (ab83565)

ab83565 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83565.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"