Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRS LHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLT TLSWQLFQTLSLRELQLEQN
    • Amino acids
      41 to 160
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159017 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 2.7.10.1
    • ETS related protein neurotrophic receptor tyrosine kinase fusion
    • ETS related protein neurotrophic receptor tyrosine kinase fusion protein
    • ETV6 NTRK3 fusion
    • GP145 TrkC
    • gp145(trkC)
    • GP145-TrkC
    • GP145TrkC
    • Neurotrophic tyrosine kinase receptor type 3
    • Neurotrophin 3 receptor
    • NT 3 growth factor receptor
    • NT 3 growth factor receptor precursor
    • NT 3 receptor
    • NT-3 growth factor receptor
    • Ntrk3
    • NTRK3_HUMAN
    • OTTHUMP00000192915
    • TRK C
    • Trk-C
    • TRKC
    • TrkC tyrosine kinase
    • Tyrosine kinase receptor C
    see all
  • Function
    Receptor for neurotrophin-3 (NT-3). This is a tyrosine-protein kinase receptor. Known substrates for the trk receptors are SHC1, PI-3 kinase, and PLCG1. The different isoforms do not have identical signaling properties.
  • Tissue specificity
    Widely expressed but mainly in nervous tissue. Isoform B is expressed at higher levels in adult brain than in fetal brain.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Ligand-mediated auto-phosphorylation.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159017 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159017 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159017.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up