Recombinant Human TrkC protein (Fc Chimera) (ab85599)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      Theoretical Sequence: CPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNANINITDISRN ITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHL RYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGE AKLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVI TCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNG FTLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNP PPTLHWLHNGQPLRESKIIHVEYYQEGEISEGCLLFNKPTHYNNGNYTLI AKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPITVTHKPEEDG SSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids
      1 to 428
    • Additional sequence information
      Fused with the Fc region of Human IgG1 at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab85599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

  • Reconstitution
    Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • EC 2.7.10.1
    • ETS related protein neurotrophic receptor tyrosine kinase fusion
    • ETS related protein neurotrophic receptor tyrosine kinase fusion protein
    • ETV6 NTRK3 fusion
    • GP145 TrkC
    • gp145(trkC)
    • GP145-TrkC
    • GP145TrkC
    • Neurotrophic tyrosine kinase receptor type 3
    • Neurotrophin 3 receptor
    • NT 3 growth factor receptor
    • NT 3 growth factor receptor precursor
    • NT 3 receptor
    • NT-3 growth factor receptor
    • Ntrk3
    • NTRK3_HUMAN
    • OTTHUMP00000192915
    • TRK C
    • Trk-C
    • TRKC
    • TrkC tyrosine kinase
    • Tyrosine kinase receptor C
    see all
  • Function
    Receptor for neurotrophin-3 (NT-3). This is a tyrosine-protein kinase receptor. Known substrates for the trk receptors are SHC1, PI-3 kinase, and PLCG1. The different isoforms do not have identical signaling properties.
  • Tissue specificity
    Widely expressed but mainly in nervous tissue. Isoform B is expressed at higher levels in adult brain than in fetal brain.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Ligand-mediated auto-phosphorylation.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 1D SDS-PAGE of ab85599 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab85599
    Lane 2: ab85599 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab85599 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    5 mg of protein was loaded per lane. Gel was stained with Deep Purple™.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Subsequent tightening of bands after treatment with glycosidase cocktail suggests the presence of O-linked glycans.

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified Human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.

References

ab85599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab85599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up