Overview

  • Product name
    Recombinant Human TRM1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQGSSLWLSLTFRSARVLSRARFFEWQSPGLPNTAAMENGTGPYGEERPR EVQETTVTEGAAKIAFPSANEVFYNPVQEFNRDLTCAVITEFARIQLGAK GIQIKVPGEKDTQKVVVDLSEQEEEKVELKESENLASGDQPRTAAVGEIC EEGLHVLEGLAASGLRSIRFALEVPGLRSVVANDASTRAVDLIRRNVQLN DVAHLVQPSQADARMLMYQHQRVSERFDVIDLDPYGSPATFLDAAVQAVS EGGLLCVTCTDMAVLAGNSGETCYSKYGAMALKSRACHEMALRIVLHSLD LRANCYQRFVVPLLSISADFYVRVFVRVFTGQAKVKASASKQALVFQCVG CGAFHLQRLGKASGVPSGRAKFSAACGPPVTPECEHCGQRHQLGGPMWAE PIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQ LSSTIHCNTPSLLQLRSALLHADFRVSLSHACKNAVKTDAPASALWDIMR CWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPSSRQRGLKR FQANPEANWGPRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRAAR LKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAAPDCPETSNQTPPGP GAAAGPGID
    • Amino acids
      1 to 659
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2)G26)dimethyltransferase
    • 2-dimethylguanosine-26 methyltransferase
    • FLJ20244
    • N(2) N(2) dimethylguanosine tRNA methyltransferase
    • N(2)-N(2)) methyltransferase
    • TRM 1
    • TRM1 tRNA methyltransferase 1 homolog
    • TRM1_HUMAN
    • TRMT 1
    • Trmt1
    • tRNA (guanine(26)-N(2))-dimethyltransferase
    • tRNA 2
    • tRNA 2 2 dimethylguanosine 26 methyltransferase
    • tRNA(guanine 26 N(2) N(2)) methyltransferase
    • tRNA(guanine-26
    • tRNA(m(2
    • tRNA(m(2 2)G26)dimethyltransferase
    see all
  • Function
    Dimethylates a single guanine residue at position 26 of most tRNAs using S-adenosyl-L-methionine as donor of the methyl groups.
  • Sequence similarities
    Contains 1 C3H1-type zinc finger.
  • Information by UniProt

Images

  • ab163152 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up