Overview

  • Product name
    Recombinant Human TRM11 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALSCTLNRYLLLMAQEHLEFRLPEIKSLLLLFGGQFASSQETYGKSPFW ILSIPSEDIARNLMKRTVCAKSIFELWGHGQSPEELYSSLKNYPVEKMVP FLHSDSTYKIKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFS VLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMD AGLSFIMANHGKVKENDIVFDPFVGTGGLQIACAHFGAYVYGTDIDYNTV HGLGKATRKNQKWRGPDENIRANLRQYGLEKYYLDVLVSDASKPSWRKGT YFDAIITDPPYGIRESTRRTGSQKEIPKGIEKWEKCPESHVPVSLSYHLS DMFLDLLNFAAETLVLGGRLVYWLPVYTPEYTEEMVPWHPCLELVSNCEQ KLSSHTSRRLITMEKVKKFENRDQYSHLLSDHFLPYQGHNSFREKYFSGV TKRIAKEEKSTQE
    • Amino acids
      1 to 463
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C6orf75
    • chromosome 6 open reading frame 75
    • dJ187J11
    • dJ187J11.2
    • EC 2.1.1
    • MDS024
    • TRM11
    • TRMT 11
    • TRMT11
    • tRNA guanosine 2' O methyltransferase TRM11
    • tRNA guanosine 2' O methyltransferase TRM11 homolog
    • tRNA methyltransferase 11 homolog
    • tRNA methyltransferase 11 homolog (S. cerevisiae)
    see all
  • Relevance
    TRM11 is the catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10(m2G10) in tRNAs.

Images

  • ab163723 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163723 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up