Overview

  • Product name
    Recombinant Human TRMT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKKSLSRSTLRSPNGFSEIGLKLEMVSQDALRRTIFPLGGLTKEFVKKIA AENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLG THKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDL LRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVCCVLQGGRVPGQRE DPAAGAVCLHAPEGPAQSWDGH
    • Amino acids
      1 to 222
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LCAL3
    • MGC99627
    • Mitochondrial tRNA specific 2 thiouridylase 1
    • Mitochondrial tRNA-specific 2-thiouridylase 1
    • MTO 2
    • MTO2
    • MTO2 homolog
    • MTU 1
    • MTU1
    • MTU1_HUMAN
    • TRMT
    • TRMT 1
    • trmu
    • tRNA (5 methylaminomethyl 2 thiouridylate) methyltransferase
    • tRNA 5 methylaminomethyl 2 thiouridylate methyltransferase
    • TRNT 1
    • TRNT1
    see all
  • Function
    Catalyzes the 2-thiolation of uridine at the wobble position (U34) of mitochondrial tRNA(Lys), tRNA(Glu) and tRNA(Gln). Required for the formation of 5-taurinomethyl-2-thiouridine (tm5s2U) of mitochondrial tRNA(Lys), tRNA(Glu), and tRNA(Gln) at the wobble position. ATP is required to activate the C2 atom of the wobble base.
  • Tissue specificity
    Ubiquitous. Abundantly expressed in tissues with high metabolic rates including heart, liver, kidney, and brain.
  • Involvement in disease
    Defects in TRMU are a cause of transient infantile liver failure (LFIT) [MIM:613070]. A transient disorder of hepatic function characterized by elevated liver enzymes, jaundice, vomiting, coagulopathy, hyperbilirubinemia, increased serum lactate. Patients who survive the initial acute episode can recover, show normal development and have no recurrence.
  • Sequence similarities
    Belongs to the MnmA/TRMU family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab163178 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163178 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up