Overview

  • Product name
    Recombinant Human TRNT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDID FATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIDV TTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNK KVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKG LAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFD KVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKN RKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQ QWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLS YIKKT
    • Amino acids
      1 to 405
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AA408384
    • C76540
    • CCA adding
    • CCA1
    • CGI 47
    • EC 2.7.7.25
    • Mitochondrial CCA adding tRNA nucleotidyltransferase
    • Mitochondrial tRNA nucleotidyl transferase, CCA adding
    • mt CCA adding enzyme
    • mt Trat
    • mt tRNA adenylyltransferase
    • mt tRNA CCA diphosphorylase
    • mt tRNA CCA pyrophosphorylase
    • MtCCA
    • MTO2
    • TRMU
    • tRNA nucleotidyl transferase
    • tRNA nucleotidyl transferase CCA adding 1
    see all
  • Relevance
    TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.
  • Cellular localization
    Mitochondrial

Images

  • ab162412 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162412 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up