Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARM SAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNS VGVRRTDKGD
    • Molecular weight
      38 kDa including tags
    • Amino acids
      31 to 140

Specifications

Our Abpromise guarantee covers the use of ab114375 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cell surface glycoprotein Trop 2
    • Cell surface glycoprotein Trop-2
    • Cell surface glycoprotein Trop2
    • Epithelial glycoprotein 1
    • GA733 1
    • GA7331
    • M1S 1
    • M1S1
    • Membrane component chromosome 1 surface marker 1
    • Pancreatic carcinoma marker protein GA733 1
    • Pancreatic carcinoma marker protein GA733-1
    • Pancreatic carcinoma marker protein GA7331
    • TACD 2
    • TACD2_HUMAN
    • TACSTD 2
    • Tacstd2
    • Trop 2
    • Trop2
    • Tumor associated calcium signal transducer 2 precursor
    • Tumor-associated calcium signal transducer 2
    see all
  • Function
    May function as a growth factor receptor.
  • Tissue specificity
    Placenta, pancreatic carcinoma cell lines.
  • Involvement in disease
    Defects in TACSTD2 are the cause of gelatinous drop-like corneal dystrophy (GDLD) [MIM:204870]; also known as lattice corneal dystrophy type III. GDLD is an autosomal recessive disorder characterized by grayish corneal amyloid deposits that cause severe visual impairment.
  • Sequence similarities
    Belongs to the EPCAM family.
    Contains 1 thyroglobulin type-1 domain.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE with ab114375 at 37.73kDa stained with Coomassie Blue.

References

ab114375 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114375.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up