Recombinant Human Tropomyosin 1 (alpha) protein (ab99214)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP09493
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDAIKKKMQMLKLDKENALDRAEQAEADKK AAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATD AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI ESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE ERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSD KLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALND MTSM
    • Molecular weight35 kDa including tags
    • Amino acids1 to 284
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99214 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • AA986836
    • AI854628
    • Alpha tropomyosin
    • alpha-TM
    • Alpha-tropomyosin
    • C15orf13
    • cardiomyopathy, hypertrophic 3
    • CMD1Y
    • CMH3
    • HTM alpha
    • HTM-alpha
    • OTTHUMP00000163688
    • sarcomeric tropomyosin kappa
    • TM2
    • Tmpa
    • TMSA
    • Tpm-1
    • TPM1
    • TPM1_HUMAN
    • Tropomyosin 1
    • tropomyosin 1 (alpha)
    • tropomyosin 1 (alpha) isoform 1
    • tropomyosin 1 (alpha) isoform 2
    • tropomyosin 1 (alpha) isoform 3
    • tropomyosin 1 (alpha) isoform 4
    • tropomyosin 1 (alpha) isoform 5
    • tropomyosin 1 (alpha) isoform 6
    • tropomyosin 1 (alpha) isoform 7
    • Tropomyosin alpha 1 chain
    • Tropomyosin alpha-1 chain
    • Tropomyosin, skeletal muscle alpha
    • Tropomyosin-1
    see all
  • FunctionBinds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments.
  • Tissue specificityDetected in primary breast cancer tissues but undetectable in normal breast tissues in Sudanese patients. Isoform 1 is expressed in adult and fetal skeletal muscle and cardiac tissues, with higher expression levels in the cardiac tissues. Isoform 10 is expressed in adult and fetal cardiac tissues, but not in skeletal muscle.
  • Involvement in diseaseDefects in TPM1 are the cause of cardiomyopathy familial hypertrophic type 3 (CMH3) [MIM:115196]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
    Defects in TPM1 are the cause of cardiomyopathy dilated type 1Y (CMD1Y) [MIM:611878]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
  • Sequence similaritiesBelongs to the tropomyosin family.
  • DomainThe molecule is in a coiled coil structure that is formed by 2 polypeptide chains. The sequence exhibits a prominent seven-residues periodicity.
  • Cellular localizationCytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human Tropomyosin 1 (alpha) protein images

  • 15% SDS-PAGE analysis of 3µg ab99214.

References for Recombinant Human Tropomyosin 1 (alpha) protein (ab99214)

ab99214 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"