Recombinant Human Tropomyosin 2 protein (ab103503)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP07951-2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDAIKKKMQMLKLDKENAIDRAEQAEADKK QAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATD AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI ENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSE ERAEVAESRARQLEEELRTMDQALKSLMASEEEYSTKEDKYEEEIKLLEE KLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLE LNNL
    • Molecular weight35 kDa including tags
    • Amino acids1 to 284
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103503 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab103503 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Alpha tropomyosin
    • AMCD1
    • Arthrogryposis multiplex congenital distal type 1
    • Beta tropomyosin
    • Beta-tropomyosin
    • Cytoskeletal tropomyosin TM30
    • DA1
    • DA2B
    • epididymis secretory protein Li 273
    • FLJ41118
    • Heat stable cytoskeletal protein 30 kDa
    • HEL-S-273
    • hscp30
    • HTM alpha
    • hTM5
    • MGC14582
    • MGC3261
    • MGC72094
    • NEM1
    • NEM4
    • Nemaline myopathy type 4
    • OK/SW cl.5
    • Sarcomeric tropomyosin kappa
    • TM 5
    • TM3
    • TM30
    • TM30nm
    • TMSA
    • TMSB
    • TPM 1
    • TPM 3
    • TPM1 alpha
    • TPM1 kappa
    • TPM2
    • TPM2_HUMAN
    • TRK
    • Tropomyosin 1 alpha
    • Tropomyosin 1 alpha chain
    • Tropomyosin 1 alpha chain isoform 6
    • Tropomyosin 2
    • Tropomyosin 2 (beta)
    • Tropomyosin 3
    • Tropomyosin alpha 3 chain
    • Tropomyosin alpha striated muscle isoform
    • Tropomyosin beta chain
    • Tropomyosin gamma
    • Tropomyosin skeletal muscle beta
    • Tropomyosin-2
    see all
  • FunctionBinds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments. The non-muscle isoform may have a role in agonist-mediated receptor internalization.
  • Tissue specificityPresent in primary breast cancer tissue, absent from normal breast tissue.
  • Involvement in diseaseNemaline myopathy 4 (NEM4) [MIM:609285]: A form of nemaline myopathy. Nemaline myopathies are muscular disorders characterized by muscle weakness of varying severity and onset, and abnormal thread-or rod-like structures in muscle fibers on histologic examination. Nemaline myopathy type 4 presents from infancy to childhood with hypotonia and moderate-to-severe proximal weakness with minimal or no progression. Major motor milestones are delayed but independent ambulation is usually achieved, although a wheelchair may be needed in later life. Note=The disease is caused by mutations affecting the gene represented in this entry.
    Arthrogryposis, distal, 1A (DA1A) [MIM:108120]: A form of distal arthrogryposis, a disease characterized by congenital joint contractures that mainly involve two or more distal parts of the limbs, in the absence of a primary neurological or muscle disease. Distal arthrogryposis type 1 is characterized largely by camptodactyly and clubfoot. Hypoplasia and/or absence of some interphalangeal creases is common. The shoulders and hips are less frequently affected. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similaritiesBelongs to the tropomyosin family.
  • DomainThe molecule is in a coiled coil structure that is formed by 2 polypeptide chains. The sequence exhibits a prominent seven-residues periodicity.
  • Post-translational
    modifications
    Phosphorylated on Ser-61 by PIK3CG. Phosphorylation on Ser-61 is required for ADRB2 internalization.
  • Cellular localizationCytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human Tropomyosin 2 protein images

  • 15% SDS-PAGE analysis of 3µg ab103503.

References for Recombinant Human Tropomyosin 2 protein (ab103503)

ab103503 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103503.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"