Overview

  • Product name
    Recombinant Human TRPC1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGP LQISMGQMLQDFGK
    • Molecular weight
      33 kDa including tags
    • Amino acids
      442 to 505

Specifications

Our Abpromise guarantee covers the use of ab152768 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HTRP 1
    • HTRP1
    • MGC133334
    • MGC133335
    • Mtrp1
    • Short transient receptor potential channel 1
    • Transient receptor potential canonical 1
    • Transient receptor potential cation channel subfamily C member 1
    • Transient receptor potential channel 1
    • Transient receptor protein 1
    • TRP 1
    • TRP 1 protein
    • Trp related protein 1
    • TRP-1
    • TRP1
    • TRP1 protein
    • TrpC1
    • Trpc1 transient receptor potential cation channel subfamily C member 1
    • TRPC1_HUMAN
    • Trrp1
    see all
  • Function
    Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Seems to be also activated by intracellular calcium store depletion.
  • Tissue specificity
    Seems to be ubiquitous.
  • Sequence similarities
    Belongs to the transient receptor (TC 1.A.4) family. STrpC subfamily. TRPC1 sub-subfamily.
    Contains 4 ANK repeats.
  • Post-translational
    modifications
    Activation of PRKCA induces phosphorylation of TRPC1 and subsequent Ca2+ entry into cells.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152768 stained with Coomassie Blue.

References

ab152768 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152768.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up