Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ8NET8
    • SpeciesHuman
    • SequenceVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRL CLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFE EVEEFPETSV
    • Molecular weight38 kDa including tags
    • Amino acids681 to 790

Specifications

Our Abpromise guarantee covers the use of ab112434 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • 1110036I10Rik
    • MGC124324
    • MGC124325
    • Transient receptor potential cation channel subfamily V member 3
    • TrpV3
    • Trpv3 heat sensitive channel
    • TRPV3_HUMAN
    • Vanilloid receptor 3
    • Vanilloid receptor like 3
    • Vanilloid receptor-like 3
    • vanilloid receptor-related osmotically activated channel protein
    • VRL 3
    • VRL-3
    • VRL3
    see all
  • FunctionPutative receptor-activated non-selective calcium permeant cation channel. It is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. Activation exhibits an outward rectification. May associate with TRPV1 and may modulate its activity.
  • Tissue specificityAbundantly expressed in CNS. Widely expressed at low levels. Detected in dorsal root ganglion (at protein level).
  • Sequence similaritiesBelongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV3 sub-subfamily.
    Contains 3 ANK repeats.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human TRPV3 protein images

  • ab112434 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human TRPV3 protein (ab112434)

ab112434 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112434.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"