Recombinant Human Tryptophan Hydroxylase protein (ab159741)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIES RKSKRRNSEFEIFVDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKED GMETVPWFPKKISDLDH
    • Amino acids
      1 to 117
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Indoleacetic acid 5 hydroxylase
    • L tryptophan hydroxylase
    • MGC119994
    • TPH
    • TPH 1
    • TPH1
    • TPH1_HUMAN
    • TPRH
    • TRPH
    • Tryptophan 5 hydroxylase 1
    • Tryptophan 5 monooxygenase
    • Tryptophan 5 monooxygenase 1
    • Tryptophan 5-hydroxylase 1
    • Tryptophan 5-monooxygenase 1
    • Tryptophan hydroxylase 1
    see all
  • Tissue specificity
    Isoform 2 seems to be less widely expressed than isoform 1.
  • Pathway
    Aromatic compound metabolism; serotonin biosynthesis; serotonin from L-tryptophan: step 1/2.
  • Sequence similarities
    Belongs to the biopterin-dependent aromatic amino acid hydroxylase family.
    Contains 1 ACT domain.
  • Information by UniProt

Images

  • ab159741 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up