Recombinant Human Tryptophanyl tRNA synthetase protein (ab116687)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPNSEPASLLELFNSIATQGELVRSLKAGN ASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEA EEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHH FLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFT KWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDIN KTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISF PAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYP KPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGG RDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGEL KKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ
    • Molecular weight
      55 kDa including tags
    • Amino acids
      1 to 471
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab116687 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Additional notes
    Although stable at 4°C for 1 week, ab116687 should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 0.58% Sodium chloride, 10% Glycerol

General Info

  • Alternative names
    • Gamma 2
    • GAMMA-2
    • Gamma2
    • hWRS
    • IFI 53
    • IFI53
    • IFP 53
    • IFP53
    • Interferon induced protein 53
    • Interferon-induced protein 53
    • SYWC_HUMAN
    • T2-TrpRS
    • TrpRS
    • Tryptophan tRNA ligase, cytoplasmic
    • Tryptophan tRNA ligase
    • Tryptophan tRNA ligase 1 cytoplasmic
    • Tryptophan--tRNA ligase
    • Tryptophanyl tRNA synthetase
    • Tryptophanyl tRNA synthetase cytoplasmic
    • WARS
    • WARS protein
    • WRS
    see all
  • Function
    Isoform 1, isoform 2 and T1-TrpRS have aminoacylation activity while T2-TrpRS lacks it. Isoform 2, T1-TrpRS and T2-TrpRS possess angiostatic activity whereas isoform 1 lacks it. T2-TrpRS inhibits fluid shear stress-activated responses of endothelial cells. Regulates ERK, Akt, and eNOS activation pathways that are associated with angiogenesis, cytoskeletal reorganization and shear stress-responsive gene expression.
  • Sequence similarities
    Belongs to the class-I aminoacyl-tRNA synthetase family.
    Contains 1 WHEP-TRS domain.
  • Post-translational
    modifications
    Proteolytic cleavage generates 2 forms; T1-TrpRS and T2-TrpRS.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References for Recombinant Human Tryptophanyl tRNA synthetase protein (ab116687)

ab116687 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up