Recombinant Human Tryptophanyl tRNA synthetase protein (ab116687)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPNSEPASLLELFNSIATQGELVRSLKAGN ASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEA EEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHH FLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFT KWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDIN KTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISF PAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYP KPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGG RDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGEL KKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ
    • Molecular weight
      55 kDa including tags
    • Amino acids
      1 to 471
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab116687 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Additional notes
    Although stable at 4°C for 1 week, ab116687 should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 0.58% Sodium chloride, 10% Glycerol

General Info

  • Alternative names
    • Gamma 2
    • GAMMA-2
    • Gamma2
    • hWRS
    • IFI 53
    • IFI53
    • IFP 53
    • IFP53
    • Interferon induced protein 53
    • Interferon-induced protein 53
    • SYWC_HUMAN
    • T2-TrpRS
    • TrpRS
    • Tryptophan tRNA ligase, cytoplasmic
    • Tryptophan tRNA ligase
    • Tryptophan tRNA ligase 1 cytoplasmic
    • Tryptophan--tRNA ligase
    • Tryptophanyl tRNA synthetase
    • Tryptophanyl tRNA synthetase cytoplasmic
    • WARS
    • WARS protein
    • WRS
    see all
  • Function
    Isoform 1, isoform 2 and T1-TrpRS have aminoacylation activity while T2-TrpRS lacks it. Isoform 2, T1-TrpRS and T2-TrpRS possess angiostatic activity whereas isoform 1 lacks it. T2-TrpRS inhibits fluid shear stress-activated responses of endothelial cells. Regulates ERK, Akt, and eNOS activation pathways that are associated with angiogenesis, cytoskeletal reorganization and shear stress-responsive gene expression.
  • Sequence similarities
    Belongs to the class-I aminoacyl-tRNA synthetase family.
    Contains 1 WHEP-TRS domain.
  • Post-translational
    modifications
    Proteolytic cleavage generates 2 forms; T1-TrpRS and T2-TrpRS.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab116687 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up