Recombinant Human TSEN34 protein (ab163970)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPL LLMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSA
    • Amino acids
      1 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HsSen34
    • LENG 5
    • LENG5
    • Leukocyte receptor cluster (LRC) member 5
    • Leukocyte receptor cluster member 5
    • SEN 34
    • SEN34
    • SEN34_HUMAN
    • SEN34L
    • tRNA intron endonuclease Sen34
    • tRNA splicing endonuclease 34 homolog
    • tRNA splicing endonuclease subunit 34
    • tRNA splicing endonuclease subunit Sen34
    • tRNA-intron endonuclease Sen34
    • tRNA-splicing endonuclease subunit Sen34
    • TSEN 34
    • Tsen34
    see all
  • Function
    Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. It probably carries the active site for 3'-splice site cleavage. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events.
  • Involvement in disease
    Pontocerebellar hypoplasia 2C
  • Sequence similarities
    Belongs to the tRNA-intron endonuclease family.
  • Cellular localization
    Nucleus. Nucleus, nucleolus. May be transiently localized in the nucleolus.
  • Information by UniProt

Images

  • ab163970 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up