Overview

  • Product name
    Recombinant Human TSGA2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EELVTVVPKWKATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGE EAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEE EETRQSDLQD
    • Amino acids
      200 to 309
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 79
    • CT 79
    • CT79
    • FLJ32753
    • H meichroacidin
    • Male meiotic metaphase chromosome associated acidic protein
    • Meichroacidin
    • MGC126568
    • MGC141927
    • Radial spoke head 1 homolog
    • Radial spoke head 1 homolog Chlamydomonas
    • RSP 44
    • RSP44
    • RSPH 1
    • RSPH1
    • RSPH10A
    • Testes specific A2 homolog
    • Testes specific gene A2 (mouse) homolog
    • Testis specific A2 homolog
    • Testis specific A2 homolog (mouse)
    • Testis specific gene A2
    • Testis specific gene A2 homolog
    • Testis specific gene A2 protein
    • TSA 2
    • TSA2
    • TSGA 2
    see all
  • Relevance
    TSGA2 (Testis specific gene A2), may play an important role in male meiosis. Its expression is restricted to the radial spokes of the axonemes of both sperm and cilia.
  • Cellular localization
    Cytoplasmic. Note: Cytoplasmic in late spermatocytes, secondary spermatocytes and round spermatids. Gathered around metaphase chromosomes during meiotic divisions.

Images

  • ab164778 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up