Recombinant Human TSPAN2 protein (ab160812)

Overview

  • Product name
    Recombinant Human TSPAN2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQ PTCPKELLGHKNCIDEIETIISVKLQ
    • Amino acids
      112 to 187
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6330415F13Rik
    • AW048009
    • B230119D02Rik
    • FLJ12082
    • OTTHUMP00000013651
    • RP4-666F24.2
    • Tetraspan 2
    • Tetraspan TM4SF
    • Tetraspanin 2
    • Tetraspanin2
    • TSN2
    • Tspan 2
    see all
  • Relevance
    TSPAN2 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. TSPAN2 may play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath.
  • Cellular localization
    Membrane; Multi-pass membrane protein.

Images

  • ab160812 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up