Recombinant Human TSPAN6 protein (ab159725)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTD TNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESE
    • Amino acids
      115 to 208
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6720473L21Rik
    • A15 homolog
    • AI316786
    • DKFZp469J2433
    • MGC117923
    • MGC133784
    • Putative NF kappa B activating protein 321
    • Putative NF-kappa-B-activating protein 321
    • T245
    • T245 protein
    • Tetraspan TM4SF
    • Tetraspanin 6
    • Tetraspanin TM4 D
    • Tetraspanin TM4-D
    • Tetraspanin TM4D
    • Tetraspanin-6
    • Tm4sf
    • TM4SF6
    • Transmembrane 4 superfamily member 6
    • TSN6_HUMAN
    • TSPAN 6
    • Tspan-6
    • TSPAN6
    • Tspan6 protein
    see all
  • Sequence similarities
    Belongs to the tetraspanin (TM4SF) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159725 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159725 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up