Overview

  • Product name
    Recombinant Human TSR2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAGAAEDARALFRAGVCAALEAWPALQ IAVENGFGGVHSQEKAKWLGGAVEDYFMRNADLELDEVEDFLGELLTNEF DTVVEDGSLPQVSQQLQTMFHHFQRGDGAALREMASCITQRKCKVTATAL KTARETDEDDDVDSVEEMEVTATNDGAATDGVCPQPEPSDPDAQTIKEED IVEDGWTIVRRK
    • Molecular weight
      23 kDa including tags
    • Amino acids
      1 to 190
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_477511

Specifications

Our Abpromise guarantee covers the use of ab183259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab183259 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names
    • DT1P1A10
    • Pre-rRNA-processing protein TSR2 homolog
    • RP1 112K5 2
    • tsr2
    • TSR2 20S rRNA accumulation homolog
    • TSR2 20S rRNA accumulation homolog S cerevisiae
    • TSR2_HUMAN
    • WGG motif containing 1
    • WGG1
    see all
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab183259, 3μg loaded. N.B. 23.2kDa (confirmed by MALDI-TOF), but molecular size on SDS-PAGE appears larger.

References

ab183259 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183259.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up