Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EILSHSWLQPPKPKATSSASFKREGEGKYRAECKLDTKTDLRPDHRPDHK LGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISGAEVGKAST
    • Amino acids
      265 to 358
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DGS-G
    • DGSG
    • DiGeorge syndrome protein G
    • Serine/threonine kinase 22B (spermiogenesis associated)
    • Serine/threonine protein kinase 22B
    • Serine/threonine-protein kinase 22B
    • Spermiogenesis associated 2
    • SPOGA2
    • STK22B
    • Testis specific kinase 2
    • Testis specific serine kinase 2
    • Testis specific serine threonine kinase 2
    • Testis specific serine/threonine protein kinase 2
    • Testis-specific kinase 2
    • Testis-specific serine/threonine-protein kinase 2
    • TSK 2
    • TSK-2
    • TSK2
    • TSSK 2
    • TSSK-2
    • Tssk2
    • TSSK2_HUMAN
    see all
  • Function
    Testis-specific serine/threonine-protein kinase required during spermatid development. Phosphorylates TSKS at 'Ser-288' and SPAG16. Involved in the late stages of spermatogenesis, during the reconstruction of the cytoplasm. During spermatogenesis, required for the transformation of a ring-shaped structure around the base of the flagellum originating from the chromatoid body.
  • Tissue specificity
    Testis-specific. Present in mature spermatozoa (at protein level).
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton > centrosome > centriole. Present in the cytoplasm of elongating spermatids. In spermatozoa, localizes in the equatorial segment, neck, the midpiece and in a specific sperm head compartment (By similarity). In spermatids, concentrates in centrioles during flagellogenesis.
  • Information by UniProt

Images

  • ab161717 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up