Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRR QKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
    • Amino acids
      174 to 273
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 72
    • CT72
    • EC 2.7.11.1
    • FKSG82
    • FLJ24002
    • RGD1559764
    • Serine/threonine-protein kinase SSTK
    • Small serine/threonine kinase
    • Small serine/threonine protein kinase
    • SSTK
    • testis-specific serine kinase 6
    • Testis-specific serine/threonine kinase 6
    • Testis-specific serine/threonine-protein kinase 6
    • TSK 6
    • TSSK4
    • TSSK6
    see all
  • Relevance
    TSSK6 is a serine/threonine protein kinase that is required for postmeiotic chromatin remodeling and male fertility. It plays a role in DNA condensation during the postmeiotic chromatin remodeling. TSSK6 has protein kinase activity against myelin basic protein (MBP), as well as autophosphorylation activity. Interacts with the heatshock proteins HSPCB, HSPA8 and HAPA1A. These interactions appear to be required for TSSK6 kinase activity.
  • Cellular localization
    Nuclear

Images

  • ab164475 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up