Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ16762
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMVHQVLYRALVSTKWLAESIRTGKLGPGLR VLDASWYSPGTREARKEYLERHVPGASFFDIEECRDTASPYEMMLPSEAG FAEYVGRLGISNHTHVVVYDGEHLGSFYAPRVWWMFRVFGHRTVSVLNGG FRNWLKEGHPVTSEPSRPEPAVFKATLDRSLLKTYEQVLENLESKRFQLV DSRSQGRFLGTEPEPDAVGLDSGHIRGAVNMPFMDFLTEDGFEKGPEELR ALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWF RRAPPESRVSQGKSEKA
    • Molecular weight36 kDa including tags
    • Amino acids1 to 297
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab117674 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional notesStore at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid multiple freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • GlpE
    • RDS
    • Rhodanese
    • Thiosulfate sulfurtransferase
    • THTR_HUMAN
    • TST
    see all
  • FunctionFormation of iron-sulfur complexes, cyanide detoxification or modification of sulfur-containing enzymes. Other thiol compounds, besides cyanide, can act as sulfur ion acceptors. Also has weak mercaptopyruvate sulfurtransferase (MST) activity.
  • Sequence similaritiesContains 2 rhodanese domains.
  • DomainThe structure consists of 2 domains of very similar conformation, suggesting a common evolutionary origin. However, the sequences of the 2 domains are very different.
  • Cellular localizationMitochondrion matrix.
  • Information by UniProt

References for Recombinant Human TST protein (ab117674)

ab117674 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"