Overview

  • Product nameRecombinant Human TSTA3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ13630
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGEPQGSMRILVTGGSGLVGKAIQKVVADG AGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNI KYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETM IHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNF NIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWV LREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQF KKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
    • Molecular weight38 kDa including tags
    • Amino acids1 to 321
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99245 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • 3 5 epimerase/4 reductase
    • 5-epimerase-4-reductase
    • anti TSTA3
    • EC 1.1.1.271
    • FCL_HUMAN
    • FX
    • GDP 4 keto 6 deoxy D mannose 3 5 epimerase 4 reductase
    • GDP 4 keto 6 deoxy D mannose epimerase reductase
    • GDP L fucose synthase
    • GDP-4-keto-6-deoxy-D-mannose-3
    • GDP-L-fucose synthase
    • P35B
    • Protein FX
    • Red cell NADP(H) binding protein
    • Red cell NADP(H)-binding protein
    • SDR4E1
    • Short chain dehydrogenase/reductase family 4E member 1
    • Short-chain dehydrogenase/reductase family 4E member 1
    • Tissue specific transplantation antigen 3
    • Tissue specific transplantation antigen P35B
    • TSTA3
    • TSTA3 antibody
    see all
  • FunctionTwo step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.
  • PathwayNucleotide-sugar biosynthesis; GDP-L-fucose biosynthesis via de novo pathway; GDP-L-fucose from GDP-alpha-D-mannose: step 2/2.
  • Sequence similaritiesBelongs to the fucose synthase family.
  • Information by UniProt

Recombinant Human TSTA3 protein images

  • 15% SDS-PAGE showing ab99245 (3µg).

References for Recombinant Human TSTA3 protein (ab99245)

ab99245 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"