Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMGEKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDE AHLQ EDQGEEECFHDCSASFEEEPGADKVENKSNEDVNSSELDEEYLI ELEKNMSDEE KQKRREESTRLKEEGNEQFKKGDYIEAESSYSRALEMC PSCFQKERSILFSNRA AARMKQDKKEMAINDCSKAIQLNPSYIRAILR RAELYEKTDKLDEALEDYKSIL EKDPSIHQAREACMRLPKQIEERNER LKEEMLGKLKDLGNLVLRPFGLSTENFQ IKQDSSTGSYSINFVQNPNN NR

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • FLJ46404
    • Tetratricopeptide repeat domain 1
    • Tetratricopeptide repeat protein 1
    • TPR repeat protein 1
    • TPR1
    • Ttc1
    • TTC1_HUMAN
    see all
  • Sequence similaritiesContains 3 TPR repeats.
  • Information by UniProt

References for Recombinant Human TTC1 protein (ab88996)

ab88996 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"