Overview

  • Product name
    Recombinant Human TTC15 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEDAGGGEETPAPEAPHPPQLAPPEEQGLLFQEETIDLGGDEFGSEENET ASEGSSPLADKLNEHMMESVLISDSPNSEGDAGDLGRVRDEAEPGGEGDP GPEPAGTPSPSGEADGDCAPEDAAPSSGGAPRQDAAREVPGSEAARPEQE PPVAEPVPVCTIFSQRAPPASGDGFEPQMVKSPSFGGASEASARTPPQVV QPSPSLSTFFGDTAASHSLASDFFDSFTTSAFISVSNPGAGSPAPASPPP LAVPGTEGRPEPVAMRGPQAAAPPASPEPFAHIQAVFAGSDDPFATALSM SEMDRRNDAWLPGEATRGVLRAVATQQRGAVFVDKENLTMPGLRFDNIQG DAVKDLMLRFLGEKAAAKRQVLNADSVEQSFVGLKQLISCRNWRAAVDLC GRLLTAHGQGYGKSGLLTSHTTDSLQLWFVRLALLVKLGLFQNAEMEFEP FGNLDQPDLYYEYYPHVYPGRRGSMVPFSMRILHAELQQYLGNPQESLDR LHKVKTVCSKILANLEQGLAEDGGMSSVTQEGRQASIRLWRSRLGRVMYS MANCLLLMKDYVLAVDAYHSVIKYYPEQEPQLLSGIGRISLQIGDIKTAE KYFQDVEKVTQKLDGLQGKIMVLMNSAFLHLGQNNFAEAHRFFTEILRMD PRNAVANNNAAVCLLYLGKLKDSLRQLEAMVQQDPRHYLHESVLFNLTTM YELESSRSMQKKQALLEAVAGKEGDSFNTQCLKLA
    • Amino acids
      1 to 735
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CGI 87
    • CGI87
    • DKFZp547E107
    • FLJ36862
    • Tetratricopeptide repeat domain 15
    • Tetratricopeptide repeat protein 15
    • TPR repeat protein 15
    • Trafficking protein particle complex 12
    • Trafficking protein particle complex subunit 12
    • TRAPPC12
    • TTC 15
    • TTC15
    • TTC15_HUMAN
    see all
  • Sequence similarities
    Contains 4 TPR repeats.
  • Information by UniProt

Images

  • ab162419 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162419 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162419.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up