Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVRE KRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC
    • Amino acids
      80 to 179
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABHS
    • C7orf11
    • M phase specific PLK1 interacting protein
    • ORF20
    • Russell Silver syndrome region
    • TTD non photosensitive 1 protein
    • TTD nonphotosensitive 1 protein
    see all
  • Relevance
    Defects in TTDN1 are a cause of nonphotosensitive trichothiodystrophy (TTD), also known as Amish brittle hair brain syndrome (ABHS), hair-brain syndrome and BIDS syndrome. TTD is an autosomal recessive disorder characterized by short stature, intellectual impairment, sulfur deficient brittle hair and decreased male fertility, but not cutaneous photosensitivity.
  • Cellular localization
    Nuclear

Images

  • ab165401 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up