Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPT AAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPY QDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVS KNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHL TPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQA QQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAA AAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHL NSSGSDYGTMSCSTLLYGRTW
    • Amino acids
      1 to 371
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AV026640
    • BCH
    • Benign chorea
    • BHC
    • Homeobox protein NK 2 homolog A
    • Homeobox protein NK-2 homolog A
    • Homeobox protein Nkx 2.1
    • Homeobox protein Nkx-2.1
    • Homeobox protein Nkx2.1
    • NK 2
    • NK 2 homolog A
    • NK2
    • NK2 homeobox 1
    • NK2, drosophila, homolog of, A
    • NK2.1, mouse, homolog of
    • Nkx 2 1
    • NKX 2.1
    • NKX 2A
    • NKX2 1
    • Nkx2-1
    • NKX2.1
    • NKX21_HUMAN
    • NKX2A
    • T EBP
    • T/EBP
    • TEBP
    • Thyroid nuclear factor
    • Thyroid nuclear factor 1
    • Thyroid specific enhancer binding protein
    • Thyroid transcription factor 1
    • Tin man
    • Tinman
    • TITF 1
    • TITF1
    • TTF 1
    • TTF-1
    • TTF1
    see all
  • Function
    Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis.
  • Tissue specificity
    Thyroid and lung.
  • Involvement in disease
    Defects in NKX2-1 are the cause of benign hereditary chorea (BHC) [MIM:118700]; also known as hereditary chorea without dementia. BHC is an autosomal dominant movement disorder. The early onset of symptoms (usully before the age of 5) and the observation that in some BHC families the symptoms tend to decrease in adulthood suggests that the disorder results from a developmental disturbance of the brain. BHC is non-progressive and patients have normal or slightly below normal intelligence. There is considerable inter- and intrafamilial variability, including dysarthria, axial distonia and gait disturbances.
    Defects in NKX2-1 are the cause of choreoathetosis, hypothyroidism, and neonatal respiratory distress (CHNRD) [MIM:610978]. This syndrome include neurological, thyroid, and respiratory problems.
  • Sequence similarities
    Belongs to the NK-2 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications
    Phosphorylated on serine residues.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159708 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159708 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up