Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LIEVNASPSLTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKE VLGNYEILYDEELAQGDGADRELRSRQGQSLGPRAGRSRDSGRAVLTTWK
    • Amino acids
      324 to 423
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C22orf7
    • Catalytic subunit of neural tubulin polyglutamylase
    • HS323M22B
    • OTTHUMP00000028544
    • PGs3
    • Probable tubulin polyglutamylase TTLL1
    • TTLL 1
    • Tubulin polyglutamylase complex subunit 3
    • Tubulin tyrosine ligase
    • Tubulin tyrosine ligase like 1
    • Tubulin tyrosine ligase like family member 1
    • Tubulin tyrosine ligase like protein 1
    see all
  • Relevance
    TTLL1 (Tubulin-tyrosine ligase-like protein 1) is a probable catalytic subunit of the neuronal tubulin polyglutamylase complex.
  • Cellular localization
    Cytoplasmic, cytoskeleton.

Images

  • ab161795 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161795 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up